TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1
MVKTPMFHKKIDYISQVDERDCGVAALAMILAHYKTRLSLAKLRDLAKTDMEGTTALGIVKAANALDFETMPIQADLSLF
DKKDLPYPFIAHVIKEGKYPHYYVVYGMKGDQLLIADPDNTVGKTKMTKAHFNEEWTGVSIFIAPNPTYKPTKEKKRSLT
SFIPVITRQKLLVINIVIAALLVTLVSILGSYYLQGIIDTYIPNNMKNTLGIVSLGLIFAYVIQQLLSYARDYLLIVMGQ
RLSIDIILSYIKHIFELPMSFFATRRTGEIVSRFTDANAIIEALASTMLSVFLDLGILVIVGTVLVVQNSTLFLISLIAI
PAYALVVWLFMRPFSKMNNDQMQAGSMLSSSIIEDINGVETIKALNSEATAYHKIDHEFVTYLEKSFVYAKTEAVQNAIK
SLLQLSLNVVILWVGAQLVMTNKISVGQLITYNALLGFFTDPLQNIINLQTKLQQASVANNRLNEVYLVDSEFKDSHQMT
EKITPNSSLVADHITYKYGFGAPAIDDVSLTITAGEKIALVGISGSGKSTLVKLLVNFFQPESGTISLGPTPLANLDKHE
LRGHINYLPQEPFIFSGSIMENLLLGAKPGTTQEDIIRAVEIAEIKDDIEKMSQGFGTELAESGNISGGQKQRIALARAI
LVDSPVLILDESTSNLDVLTEKKIIDNLMKLTEKTIIFVAHRLTISQRVDRILTMQSGKIIEDGTHDTLLKAGGFYASLF
NH