TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q18900|Q18900_CAEEL Abc transporter, class h protein 1, partially confirmed by transcript evidence OS=Caenorhabditis elegans GN=abch-1 PE=2 SV=1
MNEKHVLECKSISFMTAISNGTWFSKIYKPPSVFQILKNISFTATSGEIHAIVGVADSGKTTLLEALTSGAGGDIGGIAM
LDKFMLTRRRFNKFCSHINYRNQYPSSLSVRSLLYYHARLCLSSTHTSLEIDHRISELSAMFDVIGYAHDKLEDLSFSAR
RRVMTVMELLKDPILTIIDDPTAYLSPLSAYQLIYALHFYAAKFNRIIIITLRNVRSDLSHLLGSATCLFYGEVAYSGQM
RLLPNHFKKAGFECPPNENPAAYYLSLLTIDKESMQKVMETQEKATKLVAFRTDNDTSSDISGSSATGTGVLLDSGRKNP
SISTVAAILFRRVLSLIGSTPSNSLAGLIAFPVTAAVLSFLRPTSLPSSLFFWKLLTFLYLLLQTIVIFPNYSKTSLLSF
RECNLYCQTTSLTIFSIFFLVYSCIQSSLFVGIVLWSFKSEAMFQISLNLFLLSIFSFSIFTICARYLKNCSNIVILQTI
IILAFFVSGNGVTGTTTSSSIQYYIGVINPFNYSNFLLSKLLSSSIDNEECTFPSYMCKLSMNLHSDLYPPWYAPNDVFT
NFAILFCLSLTFLVISFFIHLTEPSVQLKKHMKQS