TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1DDV1|Q1DDV1_MYXXD Amino acid permease OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_0911 PE=4 SV=1
MGPFQLLSLGVNGIVGVGIFFAPAEVAALAPGASAIAAFALTGLALIPVALAFAVLGRRFDADGGPVLFARAAFGERASF
LVGWVAYVSAFLSTAAVVAGLSQAVAPSLGLEGALGRSVLASVLVTALAGVVASGIRVSAGTWTALTVFKLLPLAALLVA
FLALSGPPPAAAVAAGPVVDVSWLRAGLTVMFAYQGFEIVPVIAGQVRSSSRTVPLATVGSLLVAVLLYVGLVWACVAAL
PELASQAAPLAAAAGVWGGPGLEGWVKAGTSVSALGICLGMMVTTPRYLSALASGAHTLLGLDGMSAGGVPVRALAVTWA
LVLLFVNLGDLSELFALSSIAVLMQYGVTSAALAALAWRRERGLRPLHALLAVPTLGLGLTLVAFGANPREGVTMALTLI
AGVVLLRLSRPRASEPSAALRGEPL