TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q1J1H5|DCTA_DEIGD C4-dicarboxylate transport protein OS=Deinococcus geothermalis (strain DSM 11300) GN=dctA PE=3 SV=1
MPKIFRSLYVQVLIAIVLGILVGFLFPSFGEGLKPLGDGFIKLIKMLIAPIIFATVVSGIAHMRDTKKVGRVGGKALIYF
EVVTTFALVIGLVVANILKPGHGMNVNPATLDTSAISKYTQAAGEQSVADFLLHIIPNTLVSAFTEGDLLQVLLISVLFG
FALTQLGTLGQKVLAGIEAVNSAVFVILGFVMRLAPIGAFGAMAFTIGKYGVGTLAQLAYLMVAFYATCLLFVFVVLGLI
ARFAGFSILKFIRFIKEELLLVLGTSSSESALPRLITKLEYAGANRSVVGLVVPAGYSFNLDGTSIYLTMATLFIAQATN
THLSLGQQLGILGVLLLTSKGAAGVTGSGFITLAATLSAVGHVPVAGLALILGIDRFMSEARALTNFVGNGVATLVIARS
EKALDTNRLQRVLNGEVLPPATPEVAAEERGEGRGLDGPLPA