TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1LRE9|Q1LRE9_RALME ABC transporter-related protein OS=Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839) GN=Rmet_0391 PE=3 SV=1
MRRYSTTAEPAPAEPANSLFQGGGARRSDWQTVRNLLPYVWHYKWRVMLALTCLVAAKVANLGVPVLMKKLVDSMNIAPG
DPAALLAVPVGLIVGYGLLRLSSTLFTELREILFSKVTQSAVREIALQVFRHLHALSLRFHLDRQTGGMSRDIERGTRGI
QSLISYSLYSILPTLVEMSLVIGFFVVRYDIWFAAITICALAGYIVFTIVVTEWRTHFRRKMNELDSRANQKAIDSLLNF
ETVKYFGNEEYEARRYDENLRTYRTAAIRSQNSLSFLNFGQQAIIALGLILILWRATVGVAAGKLTLGDLVLVNTLMIQL
YIPLNFLGVIYREIKQATTDMDRMFVLLGTQQEVADTPGAPVLAVNGAEVRFRHVGFGYEKNRVILDDVDFTIAAGTTTA
VVGHSGSGKSTLARLLFRFYDVTRGSIEVDGQDIRKVRQVSLRASIGIVPQDTVLFNDSIYYNIAYGRPEATREEVIEAA
RAAQIDTFISELPQGYDTPVGERGLKLSGGEKQRVAIARTLLKNPPILVFDEATSALDSRTEQAIQSELMRLAQNRTTLL
IAHRLSTVVHADQILVMDRGRIIERGTHAELMRANGHYAEMWQIQARNAAEGSPDADALAIDVGDATQDA