TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1M4Q9|Q1M4Q9_RHIL3 Periplasmic erythritol binding protein OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=eryG PE=4 SV=1
MFKKGMRILLAAAAVAPLLASSAWAAGMMTIIVNDPSNPYWLTEGNVAKATAEKLGYTASVNAHKGDTNTESNLIDTAIT
NKSVAIILDPANADGSVGAVKKAVAAGIPVILVNAEINQEGLAKAQLVSNNAQGAALGAQQWVEAIGDKGNYAELFGAPS
DNNAATRSNGYETVLSQYPDLKKVAKEVANWDRTQGHNKMQSMLQANPDIVGVISGNDEMALGAIAALKEAGKLANVKVG
GFDGSPDAVAAIKAGELQYTVLQPVAVFSEEAVKQADNLIKTGNTGAKSEKQLFDCLLITKDNIDKYTGPFVLAQ