TCDB is operated by the Saier Lab Bioinformatics Group
>Q22NS1|Q22NS1_TETTH Permease, putative family protein - Tetrahymena thermophila SB210.
MDRDYIYEKQKVKGQSFIGTAKIIIQYLINDIKKKPRSFKIGIFSIFLVIGFISAIESAFQLSPVIFLTIGEDQAGDADI
VLTPVSFQNRTFFEKNKLIEESQNNQSAFSSIRLINSSLINDICENVEGIQGCSPRWLLLADLYNSNPETTTHQKFRSYV
ITIDSVQERSIGVGRRFKGDILNEGEAYVTAPTMRGLNLKEGDKITLNIDMVEAILKNQNLLQLKLKNQTTEAVYEAFSE
EFRKILLQSFPNLMQNEEQEMHLDKQQIVSIMNTLNKYSNTMENQNNRQAMYFALQMYLEQQGISTGDLDIIKILEPSFQ
DGSIKKIVEQLTIESNNLPEDFHLNVTEFSQQITPVLMKAMNFTQDFKVVFSVESTKGKWASALGNTIVIDSNYILQSAW
LGISQTIKKQLDNPELIQKNPSLSFIKIFYNQFNLNNTIYRRLENLDLNQYAMSSNVIFKERMHIYTGKNQIQKNIVQLT
DKFAKQTNDIHPVQSTAPLSIVVSGLLILKMFLDNMIATSIFLLFMLAVLLIYSLMISDVEEKTYEFGMLRALGFKKVSL
VYLLIAEGLIFAFPGLGLGLLMAYLVNSIIAFVIFNRSMVVTSYDLHWSAVILALCLGIFIPLLSVYLPIQRAMSKTLRD
SLDLYHRVINEISVSVQKLERLGISFSQFINSITLILTGVVCYYFAPAAFVYQDLALFLAIINVVLILMIIGFTLLLNLA
QPLVERMYVKLFLCFFKSSKHLESIITKNMEGHRRRNGKTALMYTVALSFLIFAGTGFKLQSKSIVDNLKSSLGSDLKVL
LLRDKRGLDEFGMRQFLDSYMKEFPDHIQAYSFITLPIDSFPQMSKPKFSSLSQFPTNRNLQLRGIEKNYLSSTFLDFYY
PQEFDPKMEFPYLESDQSVIDAVYGLYTDDGIQKLQNSVDFYKVGSNSDIRDQNLMGGGQSNENKDQEDPNEPLKGQDDN
GPINQISRHKFEDQEVKLIIPSGLHYISSVDVNTPCLLNFEGIKYRCRIRNTSRKFPGFRFSSYSGDAEEQDVKEFFSQV
MPNSTYGIPKSSLNIQFKQNLSQKQREIIGNGLRNYFKSDFTQLFDVNTIIEQVQETLFFIDLFSLVIASISIILSFFLI
LVSFVANIKENSWEFGVLRAIGLSKVQITRVYMIESCSLVLASGTIGTIIGLVVAVTLTLQVLMFTELPFRFVFPYEMFF
TTFFFGLFIAAAASYTALSEFKDKAISSIVKGLI