TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q26594 AMINO ACID PERMEASE - Schistosoma mansoni (Blood fluke).
MGKSKKENKDSNATESVALKKEVSVLQGVSIVVGVIIGSGIFVSPVGVLKHTKSVGLSFIMWAVTGLFSTLGAIVYAELG
VTIPRSGGEYVYILQTFGPLLAFLAFWITFVVIGSASCAANALIFAQYILRPVYMDCVTPTIVIRTVAVLGLLLLCFVHC
FSVKLATKVAVVFTACKVTALLIIIGFGLYYLGKGNVESFKNAFEDSEKSPGELALGFYQGFWAFSGWNYLNFLTGEVKN
PGRTLPIVIILSLTTVTFIYILTNVAYLAVLSPLEVLASEGSTAIAVSFASRTMGVVGLVMPALVGASVFGSINGEVFSI
SRLAFTAGEEGHMPALLSMVNIDRLTPIPSILIVVTLSVIFQMFDDILYLIELTGFAFSVMSAMAVCSLLYIRRTNPEMN
TSGFKLPIFFPVLYLIVDIAIGILAIYQKPTDCAVSLGVMLLGVPVYLFGVVWKNKPRSMRSLIYGVTITLQKVLKVVEQ
EKVSDIIELDGHLKPVDSQLDIS