TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q2V2S7|NDHM_ARATH NAD(P)H-quinone oxidoreductase subunit M, chloroplastic OS=Arabidopsis thaliana GN=ndhM PE=2 SV=1
MVAAFSYTACTKLSLLHPSMVAQIRPRTTQKAFVVTNPEQDSTLEVQETETLKEEQSTEKMKKQPTPLRPVEKQLNVKSK
GMGDFGGQWLSSVTRHVRIYAAYIDPETCEFDQSQMDKLTLILDPTEEFVWDDESCNKVYSYFQELVDHYEGAPLTEYTL
RLIGSDVEHYIRKMLFDGEIQYNMDARVLNFSMGKPRVQFNTSNIEGGGDGQPQEDA