TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q37165|NU1C_ARATH NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic OS=Arabidopsis thaliana GN=ndhA PE=3 SV=2
MIIYATAVQTINSFVKLESLKEVYGLIWIFVPIFSLVLGIITGVLVIVWLEREISAGIQQRIGPEYAGPLGILQALADGT
KLLFKENLRPSRGNTPLFSIGPSIAVISILLSYSVIPFSNHLVLADLNIGIFLWIAISSIAPIGLLMSGYGSNNKYSFLG
GLRAAAQSISYEIPLTLCVLSISLLSNSLSTVDIVEAQSKYGFWGWNLWRQPIGFIIFLISSLAECERLPFDLPEAEEEL
IAGYQTEYSGIKFGLFYVASYLNLLISSLFVTVLYLGGWNISIPYISILELFQRDQIFGTTIGIFITLAKTYLFLFVSIA
TRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSFQLFSL