TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q383C6|Q383C6_TRYB2 Glycosomal membrane protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb11.01.3370 PE=4 SV=1
MSEFQRFVKLLEQTDGRDKILKAFSGVFKALGSLDTCQSRSSAFGAVGKSIGDARCLLRMAKWVGDVPKMQNTIQDCRAK
GKVNMKEVLKFLRVLCNFLYVLGDNVAFVARYNLLALRHKSIHLKAKTAQFWGFFLAAVLDVVALYGALQKRASDPATSK
KEMKAALISFVKDASDTLVTMAFVGYLREVWRPSATTSGALTAVAGGVATYLNWNKIK