TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q389P2|Q389P2_TRYB2 ATP-binding cassette protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.329.0040 PE=4 SV=1
MSSLSTAGCVGDANVLGDSDVKVSVLSRKDRKKQERTEKLLEEQRQLREQANCVNKDGDNPFSVTWEHDKGTEGSRDISL
QRVAVSVNGKVLFKDTQVRLSAGARYGLMGPNGRGKSTILRLLSSRELPVQSNLELLLVEQEQEFHESEVSAVQAVLQSH
KKQREFASEAAQLHEKTELSHEEMERLNFLEEELDIMGAAQAEARARRILFGLGFPTEWHERPTSSFSGGWRKRIALAAA
VFIEPDVLMLDEPTNHLDLNAVIWLESYLCEQYNEKARRPKTLVVVSHDAGFLDEVCTHMVHVENYQLNYYRGGFSGFDE
QLRQRHQEIDKKYATFNKTINEKKRNGMSNAQVDEWIKDQVRTGRLDPIYLEKRRDYIVNFPFSEPPELPDGYIVKLEDV
SFNYPGGPVLFHKVSCALWADSRITLCGPNGIGKSTLLSLLTGQLEPTEGIITMNRKVRIGRYNQHFVDKLPLEKTSVEF
IQSLGIREEDKARRQLGSFGLEGIVHKNQIATLSGGQKARVALAAISAEKPHFLLFDEPTNHLDVESIEALCHAIKNFKG
GVLVVTHDARLIEETDMQIWEAGNQNVRPFNGSLNDYKNKVRREFEEQEKKMLKERHIATEEKQLNSRLAREGAGKDVAA
LKKEKEEETRQRQLAELDAAFALLDKRKKVKKVKKDKEEKANDG