TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q38DH6|Q38DH6_TRYB2 Putative uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb09.211.3300 PE=4 SV=1
MSHPDNDADLDALLDDCLNTMDEQERIHEEKAQERAATRAVDQKSATAELNPDEATMINLLRTIMESAGSDENTDADNVE
EKLASQIEEISAMLAGIPDITPEERQSYEQVLQLVQTLKDGSAASSKEGEGSGTSLSDGDDDKPSEEELATIRKVNELLM
QLGEGEGVPATEAGSAGATENADSPEFAAEALLNVLLDPQLVEPLRQMRESYPLWLAENESKTSAEDLARYKRQHEITVS
ICDFLESGAVGAQDMERMSTLVALMHEYSSLAPLPPGLADVQPSV