TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q38ET6|Q38ET6_TRYB2 Putative uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb09.160.4700 PE=4 SV=1
MVSRVFSAYAEWVRRNADNVASMERFTHMLTIILMSPNNMLKHEIGNTIVNIQNFSNHAIISSAGRKLSVAEQISIVGQI
IRKAECLLELLLRRYRGHRTAWNFLLILQLLKCFLNLVAHQQMCLLPSIWQALRRQLRRLITFPKKLLGPSGVSSGNSGA
ALSNLPQSSQAAERTTPLVIPRVVATRMFRDRSSEAVGDDADFSQAGKGSNSGGGNPDVLPCTAYDVLGAVVDFLLLLRP
LFLLYCARSAFPTTAMDACSQIASEVEDTTLDDGPRDSNVTDKKSDYGSFFSVKSLIADGLKESLLGNWSIWTLFLGLDV
IFAALARYIFHYRKPIVCINRDARNYSGVGSNGGRQIAHDGEVPSPELSGVNSAAEPDTVVSRDSLRVQQTMHNLVCCFL
RDPFFGSVLRRFIYDNFIVGRINGIPLVGSLLALHVASFLCRQHYSFMYSIGE