TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2
MADDESRTILLEKNEDCPGCIIDRTKQQQRGVPYLHLSFIWLVSLCTALPISSLFPYIYFMIRDFHIAKQEEDIGFYAGF
VGSSFMIGRALTSIFWGKLADRYGRKPIILIGTFSVIIFNTLFGLSTSFWLAISVRFLLGCFNCLLGVIRAYASEVVSEE
YNALSLSVVSTSRGIGLILGPAIGGYLAQPAEKYPNIFSQSSVFGRFPYFLPSLVISVYATAVLIACWWLPETLHTRCRI
AQGRLNPTELNDDESRGGGLDEQKIINKPSLLRNRPLMAIIIVYCVFSLQEIAYNEIFSLWAVSDRSYGGLSFSSQDVGE
VLAISGLGLLVFQLLVYPPLEKSVGLLAVIRLSAVLLIPLLSCYPYIALLSGVTLHLVINCASIIKNALSISLVTGLFIM
LNKAVPQNQRGAANGISMTAMSVFKSFGPAGGGVLFSWAQKRQDATFLPGQIFAPCDEMVFLVLNLVQLVGLILTFIPYI
SQIQ