TCDB is operated by the Saier Lab Bioinformatics Group
>Q3IVI4|Q3IVI4_RHOS4 TRAP-T family transporter, large inner membrane subunit DctM - Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158).
MDGLLIEILFGAFFALMLLGAPITVALGVSALAAMVYLGDNPIKMVQMAWSSVGSFPLMALPSFILAGALMEAAGLSRRL
IAVAESLAGPFTGGLSAATIMACLFFGAISGSGPATTAAVGMLMIPAMSRQGYGPGYAASVTAAAGGLGIIIPPSIPMVI
FGISAMGLAPPPEAIAAHGPFQSVSISKLFIAGFVPGVIMAGGLLVMNYIRCRMRGFRGSAAPLSARNVARACYQGFWAL
LAPVVILGGIYSGFFTPTEAAIVAIFYTLFVGIFIYRELDLAEVIKALDTTTWLAGRVLLVLFAATIFGRVLVENNIPGI
IAGGVLGLTTNIHAIWAMVIGMLLIVGMFMETLAAIMILVPVMLPVAYMVGIDPIHFGIVMICTLSVGFQTPPLGENLFI
ASGISGVSIERISLRALPFAAASVTAIFIIASFPELALWLPRAMGY