TCDB is operated by the Saier Lab Bioinformatics Group
>Q3IVI6|Q3IVI6_RHOS4 TRAP-T family transporter, DctP subunit - Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158).
MSSWIRHKSEPPTERETEMTQAQTFLAGTALALLAALPAWAEEFRIAVGDGAGGTQEALGKAFVAALEKESGGEMTGKLF
LNGQLGDEQDTVTAAATGTLDFSILAINNITPFSPSVGTLTLPYVILSQEDAETVTQGEVGRQMIEKTVEDAGVRIIGWG
YSGFRVLTNSKKPVASVEDMQGLIVRVPKNEIMIETYKSWGINPTPMAWGETFAALQQKVVDGQDNPYMTVYAMKFDEVQ
KYVTELRYIFSIEPLIVSEALFEGLSEEKQAQILAAGEAATQASSAFLREQESRIRDELVARGMEITPPADGEKGFIELA
TAQVWPKFADQIGGIEVLNGVLTSLGRPTVQ