TCDB is operated by the Saier Lab Bioinformatics Group
>Q3L890|Q3L890_MYCSM Integral membrane protein - Mycobacterium smegmatis.
MWSDILGLALFVSLNPLLLGFILLVLSRPRPVPNLVVFWVGCLIVNVPGFLIPLFVLRAVPSFAEFAEDLTTADPSSGIE
PFQLGTGIFALAVSAVIALRMWVKRRANQPVLVGSGAGDRGPTDDASTLVLDSGAREAREPGAIARMILRMRSALQRLVS
RLHQEWENGALWVALVFGLAYIPPPPLVLLVDTIIGGSGAPIGTQIIAVFVFIMAMLAVFEITLLSYVIAPRRTQAVLEP
LHEWSHRHRQMILLVLFGAVGIWELIVGLGVI