TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q3SPX7|Q3SPX7_NITWN O-antigen polymerase OS=Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255) GN=Nwi_2410 PE=4 SV=1
MTFRFLINPIKEKRYVLRDSWISAAHRSRTADHLAVLMAISLPWSTTIFGVFTVLWLIMLLTVIDARQFRFQFRRPAYWL
PVALFCLAAIGMLWADAPWAARIHAAGSVVKLLAIPLLMHQFERSGKGLAVFLAFLGSCTVLLALSWLSWFEPRVIPAHD
KIPGVPVKNWITQGVEFVLCIFGSAALAIVIWRRQRRYAAAGLVLLGAAFFLNMALVASSRTALVSLPILLLISTFRYMK
WREALILYTAIAITAALTWFLAPNLQERIASIQQQYASSQSQQTSVGLRLEYWTKSLRFIRNAPLAGHGTGSIRSLFERE
AGGEAVTDNQIVANPHNQTLYFALEWGVIGVILLYAMWLSHFLMFIDMRWISWLGIIVVSQNVLGSLFNSHLSDYVEGWI
YVMGVGVAGGMVSRVRKPPPVAGPAS