TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q44381 INNER MEMBRANE PROTEIN MOTD - Agrobacterium tumefaciens.
MSWFTQTVSLTQIKNADRIWLYAFGFIALLYLLIPTLIVIPMSFSDSQYLEFPPKAYSLKWFETYFGSAEWMRATFVSVR
AAFFTSIFATIFGTAAAYGTWIGSAQLRTPLSGFFILPLSVPSILIAIGSLFVFSRFGLVNTTAGLVIAHTMLAIPFVFI
VITAGLTSYDMNQEMAARSLGASRARAFFTVTLPQIKFSVITSALFAFYVSLDEVIVAMFISTGTGGTLNRKMFNALRDQ
VDPTIAAISTCMVAVSITLLVMAQIFRPKSEQR