TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q44828 Hypothetical 7.5 kDa protein - Borrelia burgdorferi (Lyme disease spirochete).
MDTIKLTELLINLNEIKLIAVMIFVTVLVLGVLILLKPLLKDILTIVIGKIFKNGNGNGKNHIKKRD