TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q45461|OPBB_BACSU Choline transport system permease protein opuBB - Bacillus subtilis.
MHHIVQFLQTNGGELLYKTYEHITISLIAVILGVLVAVPLGVVLTRMKKGAGTIIGIVNIIQTLPSLAILAFFIPLLGVG
KVPAIVALFFYSVLPILRNTYTGIRGVNKNLLESGKGIGMTPAEQVRLVELPLAAPVIMAGIRTSTIYLIGWATLASFIG
GGGLGDYIFIGLNLYQPEYIIGGAVPVTILAIVIDYVLAVAERKLTPAGMQRLKELS