TCDB is operated by the Saier Lab Bioinformatics Group
>Q45593|Q45593_BACSU YydI protein - Bacillus subtilis.
MNIANYTLKVKGKTLLQDTDLHFSSGKINHVVGKNGVGKSQLAKDFLLNNSKRIGRDIRQNVSLISSSSNIPNDVSKDFL
LHFLSKKFDAKMIDKIAYLLNLDNIDGKVLIKNLSDGQKQKLKLLSFLLEDKNIIVLDEITNSLDKKTVIEIHGFLNKYI
QENPEKIIINITHDLSDLKAIEGDYYIFNHQEIQQYHSVDKLIEVYINE