TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q45729|C15AA_BACUT Pesticidial crystal protein cry15Aa (Insecticidal delta-endotoxin CryXVA(a)) (Crystaline entomocidal protoxin) (38 kDa crystal protein) - Bacillus thuringiensis (subsp. thompsoni).

MAIMNDIAQDAARAWDIIAGPFIRPGTTPTNRQLFNYQIGNIEVEPGNLNFSVVPELDFSVSQDLFNNTSVQQSQTASFN
ESRTETTSTAVTHGVKSGVTVSASAKFNAKILVKSIEQTITTTVSTEYNFSSTTTRTNTVTRGWSIAQPVLVPPHSRVTA
TLQIYKGDFTVPVLLSLRVYGQTGTLAGNPSFPSLYAATYENTLLGRIREHIAPPALFRASNAYISNGVQAIWRGTATTR
VSQGLYSVVRIDERPLAGYSGETRTYYLPVTLSNSSQILTPGSLGSEIPIINPVPNASCKKENSPIIIHHDREKHRERDY
DKEHICHDQAEKYERDYDKE