TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4DZ99|Q4DZ99_TRYCC Calcium channel protein, putative OS=Trypanosoma cruzi (strain CL Brener) OX=353153 GN=Tc00.1047053504105.130 PE=4 SV=1
MSGVPPAYPVDSNIGVPNAHTQQRLPASGSQSNTSSRVIIGGVAPPTSTGRPHLPLPLPPVKGAASQPPLTGTGSVPAPG
HPPMGRLTPLQHRTLDGTEAQPGARPSPPPRLPMNSSTTQPTEASGAAENGDGQSSAAGGLPTFHATINPLSPISQQEQL
RQQRQHTPSRKTTDRAGTSSARSRKTMTPASQQGTRPQSAISGEETVEVLCPLPTQTRPVERFFVEFNPGAIVGNGRDDN
AMYEEALLFDRLAEYTEDDSFFSSGSSVLEEDPRRLQKDIFRERAVRSVYDTLNLRALTGGRTPQELEDKNRENAGWMYQ
VHRRAIALHHSSFFVFPAGMKARVVTYNVLHHWLMELMILLIILGYSIFTASWSRYGAPEFEKPDFMVFADFLYTILYGI
EIIARLFASGCILHSRAYFRSPWHWLDTAVFVLMIMNCTQWRDLWNFTAFRLIRIIKACTYLPLPIRMKIIAKSVLRSTC
KLFQTSIILVYALFFFALLGLQLFRGVLHYRCVNSLTGAATSQLCRPEATGHYWFYWGHVCDPGYICISDGFPNPNYDFR
SFDDVGHALLSTFQIMTFQGWTSLLQETNDAVTTLAFLYYFFTILLCAWLIPGLFIGVFIEKIEKTSRLFEQKQLELFDA
MLLEQRQRLTEAIKLRDFVERDECGRLRGHLAEAAPEDTSYPTLRVNSASSNGKFPESGSFNSRNSERNTSVVTGSSGAA
KKRTKWTDEQRVQLHLSLTRQRDIAEQGERRRRVIFKVDKKETDHTNGNFEMSSVSTNTTNNMGGGDFALGGRVGTVQHH
PLTYTIGAAHGTRLPLAVRLENEQERLQFLKYYQQAEEADDTTLQGGLTRGSRGVDGSTNNNMNSSHLSHSHPMRRGVGH
GDEMGSDIITIRESAGVIPNRRSATTRGNTSGASTSLRTSTAAAAALNGSAGGVAQSQEILIHDPEGGDFRYAKTFGQSW
GIIRNILHMFTEGCPRILTQYLWEHRRMQTRFGLLPLNYVNKYEEAALRKLRQKRARRGKLILKNNRIEDDGTDDYSEPE
EPANEDQEYLGKLSPIRMAKNIVENAPVTLFSGIMLFLVFANGVFNASRHYGQPVYWEDGLFIAGVCFTSLFMLELIIRF
IVLGPGPFVCDFINVICVIVTVIGFFELGFGHSNTITVLNWVRFLRLFRIAPFAPMRRVTRVFLLGFQDIVYALILFSVY
MFMWILTGMSFFGGRFGRLTTQNDDYATIGFFDTFSHATFAVAQAFSYVRDEWLYLSWDGMRVRGGYTIIYFLAVVFVAF
IFRYLFIAVFAWAWQQQEEREDYVLHTTSKGGHQNRGGPRLHWFDFTVWRSFKHIHGGFERRDVAPDEVFHLNQDMRRQL
RIAEAKERFTRESMTRRGFSADPQTIFSDSFSTNGNVASYGMPSSAPPLMLAPQFVNVGGQLQRQMSMPSTFDEPPPHPA
QAPISRFQAENAQLRFARRYSAVPATPYRGVAEELNGAHFLPVTSTPSDQALHNSNGSVADTAAETEGLSHQIGGRASGL
YGVHGSSNLPNEHHSSVTGYFTTLGYDKSGEKKNGEAMENYQQSSENEENGDPENSVVDGGGGGGGSGGVVYEHVLLPGP
RLRYKHIMVGRHRRVFERCLDCNVHKQIPLRAPPNVQQRTADELHAEHCHMAAVRSSRQLVLNTIIGYVRLQKELGGPPT
REAVETVLGQAWSCGMLLFESIEYLSCADIELREYRTWDRTLEALQLQQWLIGLHLGEEQVGRATLAYILAHQKTQERVA
THSSFHRSWRDRSFFIFSPSHPARRFLTAIVESKWFEWFILAVIFAASICLCFYSPEDEDRTSKKYLALHILDDIFAIIF
AVEMVLKWISMGVVLDCHVAYFWHRWNTFDCFITIISLIAIAPKYSHFRFLKVMRCFRILGPMRYCRFNKELSKLALTMW
DSVPTLVNVLLLFLLNYIVWSILALRLFMGLTHSCTSHAFSNKTSCEEAGAMWLGPQRNFDNFYESLLTMFEVSTGSRWL
DVIYTGVDGWSMEFEPIYNRHPSKGLFFVAYYYVSHFVLFSLFVASLIYCYLLAKNAAEGVTDITFEHQLWLRMQRMILR
LRPRVELVPLGNCLSRFLHRIVIHPAFELVMAGILLCNMITMSLYWYGNSSRQEKALDILEHLWVAFFTLEILMKLTAHG
LRAFSRYSFCFQVFVTSLSYLQIGLNTTVGNHVPFNVNTLRLLHLGRMLKLVDFLVPVRHHLHLLHEALLLSASSLVNVT
LILALAVFVFAVLGMHFIGPVVPVAGQYIDDTYNNFRTFPNALMMIFRLATLEDWVSMLRSSMSDGNNCPISDCKTTNWA
PVFYVPIVICFALMIVNLYLAVVVDHYVTVVRMKASVARINDLRRFRDLWSARDPNATLLLRTRKLPELLEALRPPLGLS
SRKNRAELLRLLREYDIPDHGGKVHYYEVLLPLARRVLAMAFSEDEIDDGVKFEAVWRLSESSLRALPTVLVHHSSATAA
QHFAASYVQAAYRRDKACRKLHEMRANCWREARRICDELGLPYKDYGFGDVSLEDEDPRNEAARRGLLNESTNEEKKQKN
AADVTAAAAFAAAGRSESMTTDSNESSGKPAPAARLPGLYQPAIDEKEKRFGPDVPHAVRRHETRSDKLRRKEEERQQQQ
QQDPMDRQPSVPPAPRSTAQRNQSIDYQPPLGTDPSEWLQNEMGRRMSGAGAGTLSSANHTGAGGGASPTKATAPPSSEG
LDGNV