TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4L1M3|Q4L1M3_HALAS Permease protein OS=Halobacterium sp. (strain AS7092) GN=halT1 PE=4 SV=2
MPVQGWLVRRGLSEWTGALAATVVGFVAAIAVFAPIVVALYFRIEQVLDAVEALPRELSVTVLEATHTVEAGEIQALAVD
YLSDAATSFALALPVLGIKFALFIVLMFGLLLKGDEAGRAAVAPIPHDYRDVVYALTKRARETLYAIYVLQVATSIATLL
VAYPLFRLLGYEAALTLSIMAAVLQFVPIIGPSMLIAPITLYHVAVGDLVAATLIGVLGLVFVAWLPDIAVRPRLSRRSA
GLPGSLYFVGFTGGLFTLGPIGIVVGPLIVAVFVEAVDLLADEVNGDATFTELVEADDQEPPNGAADTETTFEESSSQAA
DD