TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q52812|AAPJ_RHILV General L-amino acid-binding periplasmic protein AAPJ precursor - Rhizobium leguminosarum (biovar viciae).
MKNKLLSAAIGAAVLAVGASAASATTLSDVKAKGFVQCGVNTGLTGFAAPDASGNWAGFDVDFCKAVASAVFGDPTKVKY
TPTNAKERFTALQSGEIDVLSRNTTWTINRDTALGFNFRPVTYYDGQGFMVRKGLNVKSALELSGAAICVQSGTTTELNL
ADYFKTNNLQYNPVVFENLPEVNAAYDAGRCDVYTTDQSGLYSLRLTLKNPDEHIILPEIISKEPLGPAVRQGDDQWFDI
VSWTAYALINAEEFGITQANVDEMKNSPNPDIKRFLGSETDTKIGTDLGLTNDWAANVIKGVGNYGEIFERNIGQGSPLK
IARGLNALWNKGGIQYAPPVR