TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q52815|AAPP_RHILV General L-amino acid transport ATP-binding protein aapP - Rhizobium leguminosarum (biovar viciae).
MAEAPAKKLTVSATEVAVEIVNMNKWYGDFHVLRDINLKVMRGERIVIAGPSGSGKSTMIRCINRLEEHQKGKIVVDGTE
LTNDLKKIDEVRREVGMVFQHFNLFPHLTILENCTLAPIWVRKMPKKQAEEVAMHFLKRVKIPEQANKYPGQLSGGQQQR
VAIARSLCMNPKIMLFDEPTSALDPEMIKEVLDTMVGLAEEGMTMLCVTHEMGFARQVANRVIFMDQGQIVEQNEPAAFF
DNPQHERTKLFLSQILH