TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q54KK4|Q54KK4_DICDI Putative uncharacterized protein OS=Dictyostelium discoideum GN=DDB_0219216 PE=4 SV=1
MSLENSNIVNFQKEGAIIENEGINSSHEEDNHSHYDGLKKNTIGVIECIALSVGGIGLSAATFFVYPNIAASAGTSVPFT
IFFGALCCLTVANTISIFGKYISSSSSFFVYITKGLGNEMGFLSVWILMIGYLAIMMSAMFMFVGSLSDVITRHSDFHCP
WILSLLIVVTIIPTLAYIGIDVVLKTSIIAMILETLVILGLSFTIVIKGGDQGNYPLAFTPVGEYSGGVSGIATGLVYCT
FIFVGFEGAATLGQETRNPKKNIPIAVFGSIAFAATWFIWAMYALVVAAGPSNIFSIDTNEFPVGIYAKRYIGFWYSVII
DIAGVVSTFGVISSWFNIVFRIIYSIGKTKEKGIISWFGRTNQKFKTPHNAIISLTGFIILMSSIIVGSTKSIYTESSWE
VYNYISFTGTIPIILIFIISNIAVIRYVKVYQSKDFQLFRHMILPIFSAILFTVILGGNFYPSPKYPIPYFLIGLGILLL
MGVCVMFFLYRFNKEYLKNMLYQMSL