TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q55106 CYTOPLASMIC MEMBRANE PROTEIN B (CMPB PROTEIN) - Synechococcus sp. (strain PCC 7942) (Anacystis nidulans R2).
MVTARETRRNGSRPSGLKKWRQKLDGILLPLAGILGFLIIWQIFSSSGATRLPGPLSLFTEERTRELLLYPFLDRGGLDK
GLFWQTIASLTRVAQGFSIAAIIGISVGILVGLNRQLNAMLDPLFQFLRMIAPLAWVPIALVAFQQNQPAAIFVIFITAV
WPILINTAEGVRQIPQDYNNVARVLRMSKSKYLMKVVLPAALPYIFTGLRIAIGLSWLAIIAAEIVMSGIVGIGFFIWDA
YQQNYVSDIILAVIYIGAVGLLLDRFVAWLQRWILRNM