TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q55387 HYPOTHETICAL 46.7 kDa PROTEIN - Synechocystis sp. (strain PCC 6803).
MNNLVGDFFRMRLFWPQSRRRLTAIALNLALAGTTAGLMFACAEPEPTPGDGASQPSTGGEGGALKLGALLPATGDLSSI
GQNMPLAVQLAVDTINACGGVNGQDVTVVIEDDQTDPTAGVSAMTKLAEADQVAGVVGSFASSVSSAAVPIAVRNNIMMI
SPGSTSPVFTDQAKKGEFKGFWARTAPPDTYQAQALAALAKKQGFTDAATVVINNDYGVGFEKVFVESFTADGGNVTNKD
NPVRYDPKAATLDTEAAQGFANSPDAVAAILYADTGSVLVQSAYRQGLMDGVTLLLTDGVYSPDFVEKVGKDANGVSLLS
GALGTVPGADGKSLEAFTAQWKDATGGKDVTAFVPHTYDATVLMMLAAEAAKSNTGAGIQSKIRDVSNGPGEEVTDACEA
IAMVREGKDINYQGASGNVDIDENGDVVGTYDVWTVKGDGTLEVIDKVTPGSGS