TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q56992|HMUU_YERPE Hemin transport system permease protein hmuU - Yersinia pestis.
MNGRVQPRLMLGFLLILLVILALGSANMGALSLSFRTLWNTSTNDAMWHIWLNIRLPRVLLAVVVGCALAVSGTIMQGLF
RNPLADPGLLGISSGAALCVGLIIVMPFSLPPLLALYSHMVGAFIGSLAISTIIFTLSRWGHGNLARLLLAGIAINALCG
AAVGVLTYISDDQQLRQFSLWSMGSLGQAQWSTLLVASSLILPTCILGLLQARQLNLLQLGDEEAHYLGVNVRQAKLRLL
LLSAILIGAAVAVSGVIGFIGLVVPHLIRMRIGADHRWLLPGAALGGACLLLTADTLARTLVAPAEMPVGLLTSLLGGPY
FLWLILRQREQRSG