TCDB is operated by the Saier Lab Bioinformatics Group
>Q57306|Y355_HAEIN Probable ABC transporter permease protein HI0355 - Haemophilus influenzae.
MKIRLLKPLLIVGVLLMIWQMVATLGSFPHYIFPSPQAVRQQLFTHAELLWQHTQVTLLEICLGLLLGFLFGLISALLLS
FSRQISAVLLPILVISQAIPVFAIAPLLVLWFGYGMASKIVMSVLIIYFPVTAACYDGLRNTPQAWLDLAKTFNISPLRL
LLKVRLPAALPAFASGLRIAVSVAPIGAVVGEWVGSSEGLGYLMIHANARMQVDLMFAALLILVSISLCLYFSIDWLLHR
FIWSV