TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q58762|WTPC_METJA Molybdate/tungstate import ATP-binding protein WtpC OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=wtpC PE=3 SV=1
MLKVNNLSKIWKDFKLKNVSFEIDREYCVILGPSGAGKSVLIKCIAGILKPDSGRIILNGEDITNLPPEKRNVGYVPQNY
ALFPNKNVYKNIAYGLIIKKVNKLEIDRKVKEIAEFLNISHLLNRDVKTLSGGEQQRVALARALILNPSILLLDEPTSAV
DIKIKESIISELKKIKHIPVLHITHDLAEARTLGEKVGIFMNGELIAFGDKSILKKPKNKKVAEFLGFNIIDDKAIAPED
VIIKDGNGGEVVNIIDYGKYKKVFVKYNGYIIKAFTERDLNIGDNVGLEFREQTKLT