TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q59WR6|Q59WR6_CANAL Potential low affinity Ca2+ influx system membrane protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FIG1 PE=4 SV=1
MNLPLKFTIVFTIIIQFITAALLSFLLLGCIDTSSNYSNVYLLSYKFNQSSPLYDYLSTSSNSSITTTTTTNNNSTAIDE
LSVKVGYMGVCLSSSSKDISCTTYTGLDSFPKFSISMLSGDLDLVQLAQSFSNICHPRILLATIILTLIGLIILCYCVIP
IVPGKSIMKKLNAGLSFILLLLWGLGSMLQHQAVVTSVEMMQQSSFQLLIGTRGGRAEAMTWTAFSFILMMFLSACLSWW
MEIRMSKLNGKSSQHQQQPSVDTKI