TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5ATG4|Q5ATG4_EMENI Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ANIA_08416 PE=4 SV=1
MGLRERLQVKQGDASLATEAVASNKDLDPIPLDSPKRTWRWPSLLGFWVAEAFSISMYQVTSTSVSKGLSAPMAIAAVVV
GHILVCIPAMLDGYVGAIFGINFPVYTRASFGMKGSYFAVFVRGIVAIIWFGTQTYQAGQCVSTMLSAIWPSFNHFPNHL
PSSGPITSAELLCFFLAIILQAPLLWLKVSKLRYLFIVKTCIMPIFGIVLFAWAVKAANGFGPVFSKPSKITDGTPVAVV
FLQCVTSAIGPKATLALNMPDFTRYAKTPREVFWTQAVGLVVLVSLCGVLGATVSSASEVIYGVQTWNPLEVAVLWNNRA
AQFFAAFCWCLAAIGTNISANSVSFSNDLALWFPKYVDTRRGAYICALLSILSMPWYIQNSAASFSSFLGGYSLFLGAIA
GVIVVDYWVCRGRRLRLRSLYEAHGTHYFTKGVNIRAMISFVCGIAPNLPGLAAVTGQDGVPKGANYLYSCSWLVSIVVS
GMVYYLLFFVWPFDVEEKVIVLEGMEEGDRVVRVEEAVVQKKEAVSA