TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5AVV9|Q5AVV9_EMENI Mechanosensitive ion channel protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07571 PE=3 SV=1
MTTPVNEVPEPSYPAAERRRRSDSDSSPTVDGNAYVHDESQPHDGAYAGAQYGSHLQVDTTFQDFDKTSRSPSAAREQAM
RLEDDLAVLEAERVASRSTHGTEKDARSGDVHSLTRSRSRRAEDVDEFDEATNPLHEKAAVYNPPENPSTGVSKFIKRVH
ESSFIVRYFTYIVPLVLILLIPLLVGALAYPDASVGGVELLWFSVWLEIVWLTLWAGRIVAKLLPTPVNIFASIFTNNSK
KWRDVAKQLELPVTLFLWWLGVEISFLPTMKNHHVDGNSRTRDWENTLNKIIISVFVWTILNLIEKFLLQLIAMSFHRRT
YSDRIEINKFQIGSLTKLYAFSRNKIAETDEAFEEKQDKSGSGAKTPLRYAGKARGLALGALNKVGDVAGAVAADFTGRK
ANSSSHPSQVVIALLRTTAGCQTLARRLYRTFVREGFDTVFPGDLKEAFDDNEEAEAAFSMFDKDMNGDISMEELEAVCV
EIGRERKAITASLKDLDSVVSRLGNVFEFFVAVIAIIVFLTLISTSAAGVLTSAGSSILALSWLFSATAQEFLQSVVFVF
VKHPFDVGDRVTIYGNSGEAGLGDDYYVKQISLLYTEFKKMQGHIVQAPNSYLNTLFVLNQRRSGALAEAVPVVIKYGTT
LEQMDALRQRLLEFVRSERREFQTNILTELRAVTENFSVTLNVVFFYKSNWQNEGLRLQRRNKFICMLMVALQEIGIEGP
RMNLQGASVDIPYHIAGFPPPYQARDGPPVNDDGGQHPPHTPSSGDDQHHQPGHSPSYRRPSILRKGMVAANARARGVSI
SSRKHVDFSLGMRDVASNDIMGDVFEARSPAADSAVRQVIAERRIQEEEAERQSVESSRQRNSGSRTNLTVPTSTNEARH
SIDSQGASSLSSISRNRFFRHRSHSHSTRQEDLMEQGRSSEQGSSSAAAIRPISPSYHPDEKKL