TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5CYZ4|Q5CYZ4_CRYPI P-type ATpase 3 integral membrane protein with signal peptide and 12 or more transmembrane domains possible MgtA, cation tranport ATpase OS=Cryptosporidium parvum (strain Iowa II) GN=cgd7_460 PE=3 SV=1
MKLGIFGDIYSTFFPIDLCIKLLIFTISILLFFYIANLIIWRRYDKHTYKHQSFEMILIPCRKNIYSNIFRCTLNFLTAV
HLILIPLVTYDSVSAPESSSILYWRKKAEVFLVEYVVALIICIGRKLFTQRIRLTLIMPSNLFDCNFVCLWVRDNNNINN
NHNHDHNTNDNIIQSINKDPSYSTLNKKFLNFYKKSLAFLDGEMTGFKYYGCHIQTDESSGIRYFIAGSTRFVFSIETGT
FLPQIQSSRVSVNQIENALNCGGHSEASVISYLSVFGKNELPYETEPALLVMKRIFFCPTFILQYLMLSTTFFLRFFTWS
FCWSALILYTNLFSFFKDIFRNRKLLKETHEINNRPVKVIRGNIKKSIKASDIVLFDIVLSETGDIAPCDMILMEKLVLV
DESSLTGEATPVFKKPLDLSALSNSQILSASDNILKDSLIHAGCKIIKVFGGDESNDSLISVVLNTGVFTFKSKILRTVS
QNMISDDFHNDIPLLWLLTLSVASVVITVQCLISQFNIGSIFFILGTLLQLLPIWAPAFVQSCINSSVSTLKNDKNVESS
YPRRILFASKLDTLFFDKTGTLTMNDYVLDNVERLNSDLLEDQGFFTGNERYSERIVRGINGEKIDILKMAISTCHSLSF
VPDQGDGGYYGDSIEKEMLKFTRSCIYEKSSLNDRSLRRFVFEKGAEFDLENIYRSHNTANLEKKLSKGCEILKIFDFNG
VSRSMSVIVRCNVTDRVFLFTKGASESILKFSIKNQSTEEIEFRTSKLSSSGFYVIIIAYRELKSDKESIELYRLLNESE
RINFEVDLIPVGILCFSNCIRKEAPFIIKEIKDLGIKPIILTGDNSDCALCVAKQVGIINSQFKVSNIEAKLNLCEIDLN
SHQIAVLCCIISGKLVFLNEFRHEIDLEEVIKNLNKIRLVVTFESYEMMSKTILHNYEGIVNPLKNDSKQAFLSNETLLD
LFKNNISVISRANHINKQSVIRQFMNEGKIVGMVGDGTNDVAAVKDSNLGIFVNKNGSLSSHFSLDKGDLNGILSIIREG
CGCAANSRSLYLFMIMYGFTIVICKNILLYSGQATLPTMGYFYYSIFVNFPSVWGIKRSRPANKIKKYPVDAGLVSRSSI
LTVICFVSVIGINLGVVLFLLSNKSWFVSSYTRNLGIPIFISARQDGFESSTTLIWMCSLHSHMALIFGMGGYHREPFYK
NKVLVSTWFLAQLGLLFLIFSEPSLITCFFKINCQEGITPGTLFGMNIPKFSSSNVFPFSWKFELVGWIAASFLICIFIY
RKLNFNSASKI