TCDB is operated by the Saier Lab Bioinformatics Group
>Q5FA63|Q5FA63_NEIG1 Putative ABC transporter, periplasmic binding protein - Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090).
MKHLKLTLIAALLATAATAAPLPVVTSFSILGDVAKQIGGERVAVQSLVGANQDTHAYHMTSGDIKKIRSAKLVLLNGLG
LEAADIQRAVEQSKVSYAEATKGIQPLKAEEEGGHHHDHHHDHDHDHEGHHHDHGEYDPHVWNDPVLMSDYAQNVAETLI
KADPEGKVYYQQRLGNYQMQLKKLHSDAQAAFNAVPAAKRKVLTGHDAFSYMGNRYNISFIAPQGVSSEAEPSAKQVAAI
IRQIKREGIKAVFTENIKDTRMVDRIAKETGVNVSGKLYSDALGNAPADTYIGMYRHNVKALTNAMKQ