TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q5M244|ECFA1_STRT2 Energy-coupling factor transporter ATP-binding protein EcfA 1 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=ecfA1 PE=3 SV=1
MGISLENVSYTYQSGTPFERRALFDMTVTIKDGSYTAFIGHTGSGKSTIMQLLNGLYLPTSGQVKVDDTIINSQSKNKEI
KPIRKKVGLVFQFPESQLFAETVLEDIAFGPQNFGVSKEEAEQRALESLRLVGLSDELRDQNPFDLSGGQMRRVAIAGIL
AMQPDILVLDEPTAGLDPQGRKELMSLFKQLHLSGITIVLVTHLMDDVADYATAVNVMEKGRLVLSGTPKDVFQKVAFLK
EKQLGVPKITEFALQLQEKGYSFESLPITIEEFVEVLVHG