TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5UXW9|Q5UXW9_HALMA Putative uncharacterized protein OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rrnAC3178 PE=4 SV=1
MDGNRVATVVGFAAALAVLSGLVWLVGIGETLDALATADPEALLAVAGIAILWLVSWGLALWTVLQALGAPVAPHTAVLV
FVAAVFSNNVTPFGQAGGEPVSALLISTAADTEYETGLAAIATVDTVHFLPSVGYAIVGFTFVAAGAVQLTRNLAFAAGA
VAVLAVGIPTAAVLGWRHRDRVQALVIRGVSPALTALSNVVPRWSPPSAENIEARIEGFFSAIERIATDRRTVLQTFGLS
AFGWVCLSASLWTSLYAVGAPVPVEVVLLVVPVGSIASVVPLPGGSGAIETVLVTLLVSTAPVSAALATSAVLIHRVGSY
LLPTVIGGGVAAALGVDRAASPGE