TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q5X1N2|FEOB_LEGPA Ferrous iron transport protein B OS=Legionella pneumophila (strain Paris) GN=feoB PE=3 SV=1
MTHALLIGNPNCGKTTLFNALTNANQRVGNWPGVTVEKKTGEFLLGEHLIEITDLPGVYSLVANAEGISQDEQIAAQSVI
DLEYDCIINVIDACHLERHLYLTSQLFELGKPVVVALNMMDIAEHRGISIDTEKLESLLGCSVIPIQAHKNIGIPALQQS
LLHCSQKIKPLKLSLSVAAQQILNDLENQLISKGYKNSFAYYFSRRLAEGDTLIGEKAFTESLLIKLQETEQNLDVLLAD
ARYQKIHEIVTLVQKKHSDASEHFTAKLDKLVLHRFLALPIFFAMMYLMFLFAINIGGAFQDFFDISTETIFVQGSGWLL
QQLHAPNWVIALVANGVGKGINTTITFIPVIAAMFFFLSLLETSGYMARAAFVVDKAMRAMGLPGKSFVPMIVGFGCNVP
AIMAARTLDSERDRLLTVMMSPFMSCSARLAIYAVFVAAFFPSGGHNVVFSLYLIGILMAVFTGYILRKTTLKGHASPLI
LELPAYHRPSLRRLLRETSLRLRFFVYRAGKLIIPICVILGGLNAITWGGGISSGEANTDSLLSIIGQWITPLFAPMGIH
QDNWPATVGLLTGMLAKEVVVGTLNSLYAQVGHVGEIAAAHFDFWGGIKAAFGSIPANLSELGSALWNPVSASAADSELS
QSVYGIMSRRFDGAVGAYAYLLFVLLYIPCVSTMAVIRQEANKRFMWTSIVWSFVVAYTTSVVFYQGAKFLDHPQQSMIW
ILAMSLSLLFVLAVFRYSQYGMGRQNAAANT