TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6MLX4|Q6MLX4_BDEBA ABC-type multidrug transporter permease protein OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=Bd1879 PE=4 SV=1
MKTLLGFIKKEFRQTLRDPRMRILLFLAPCVQLTIFGVALSTEANNIRLSLVGAPNDSSLQELHRKALASGWFVPAKPSL
SDPYEQIQKGQADAVLIAPTGGLDRALGRKEGEVQLLINATNVTRAQGIERYMGSILRSLHPQDPPLQFDVRVLYNPAMR
SALFLVPGVMSMLVCLITILLTSMSIAKEKELGTFETLISAPVSPEEVILGKTVPFVLLGLSNIPLIVGVAVVLFGMPMR
GSLWMLLLAAVAFVCCTVGIGLFISTVAKNQQQSMMGGFLYLFPSVLLSGMVFPVENMPWALRIFSYINPLTYFIELLRN
IMLKGGDLRLIAVNVLILVAMAVLAITASWRRFKTTLS