TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6MLX6|Q6MLX6_BDEBA ABC transporter multidrug ATP-binding protein OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=Bd1877 PE=4 SV=1
MNSVEVRDLSVKFGDYYAVKNISFTVRRGEIFGFLGANGAGKTTTIRVLCGLLLPSHGETRVCGLDVQQNSFAVKKKVGY
MSQKFTLYDDMTVAENFSFTGSLRKIADARLKEQKDRLLQFIHFRASENTLVKDLPGGIKQQVSLVSALLHDPEIVFLDE
PTAGVSPAYRQRFWSLIQELATSGKTVFVTTHYMDEAERCQRIALMRSGELIALEAPEGLKRKNFPDRDPRDVSLEEVFI
AEVEGQ