TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6MP31|Q6MP31_BDEBA Preprotein translocase subunit SecG OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=secG PE=4 SV=1
MPHHVAQNRSLWGGRKPPLSIYLGVFGRLHKMTTFIGVLHIIVALVLIILVLIQDSKSDGALGMGGSSGSNSLLGATGAQ
SLAGKMTVWAAIIFAVTCLALATLTSSKTKSVVDSLPLPTAPTQEHFPTEGTTDAGAAAAVPAATPAEAATPAATAAPAQ
K