TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q6MR29|SECA_BDEBA Protein translocase subunit SecA OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=secA PE=3 SV=1
MVTQILTKMFGTKHDREMKKIQPTVDRINALEPQMAALTDDQLKAKTPEFQERLKKGETVHDILPEAFAVCREASKRVLG
MRHYDVQLIGGYVLNRGNIAEMRTGEGKTLVATLPVYLNALTGRGVHVVTVNDYLVRRDAEHMGRLYGWLGLTTGIIVHG
LTDQQRKQMYACDITYCTNNELGFDYLRDNMKFDLNDYVQRPHYYAIVDECDSILVDEARTPLIISGPAESSTDKYYAVN
QIIPHLKRDVHFTMEEKSKTASLTDAGNAKVEELMGLSNLYDPQNIEILHHVYQGLKAHYLYRLDVEYMIKDGEIVIVDE
FTGRLMPGRRWSDGLHQAIEAKEGVEVKSENQTLATITFQNYFRMYEKLSGMTGTADTEAVEFKKIYNLEVNVIPTNRPI
QRKDQEDVVYKSEKAKFKAITADIKERMAKGQPILVGTESIEKSEALSAFLRKEGVKHEVLNAKHHEREAEIIAQAGRKG
AVTIATNMAGRGTDIMLGGNADMLAKAQVGNDDSPEFAEAVQKIKPQVEAERAEVRSVGGLYIIGTERHESRRIDNQLRG
RSGRQGDPGESRFYLSLEDKLMRIFNGERIQKIMEMLNIPEDEPITAKMVTNAIEGAQRKVEGHNFDIRKNLMEYDSVMN
AQRNAIYGMRRKVLEGQEIERTTLDWLGDVVSNLLDTHIPEGGKKEEWSLEGLNNSLAQSFGFKIDFATMAVNTETVTDA
VKSGVKEVWERQKNSMGPFFEQVQKMILLQSIDHHWKNHLYVIDKLKEGISLRGYAQKDPLIEYKKEAFKAFETLNNTIK
SDAIEKVMRVQLVAQQNEQEVLESLRPEEADLDELDYSSPSEADIGHSIPETSEDAPKRKMTFQSGPRDDRPMNREERRR
MDKDTKGKR