TCDB is operated by the Saier Lab Bioinformatics Group
>Q6NE63|Q6NE63_9PROT MamH protein - Magnetospirillum gryphiswaldense.
MEPGRSEVEGHQRNALYLLSALCMVFMTLVVAIQPLFLRNVLNIPFETAGAVNANVQVVTEVLDLFIFAYLGYLSDRIGR
VRIIVAGFLVAAVGAVIAPLSPWVGGASIGALVVYYVSRVIMSAGSGAVWPQLSALAGDFSDDSNRARLLSNTAFMMAFG
VTLVYAVLMQIPGHAGITVTMLLTAAISVAGAWLARKFLVDVAPRTVETSVPWRAVWDLVKAEPRLRLAFASSLFARSDM
VFVGLFLMLWFIYFADLVKVGQAEAAARAGMLIGLMGAVVMLSIPVWRSFIERFGRIQAVLLGMMLSALGFIMLGFVVNP
FDGFIVFPILLVSAGQAGCFVAPQILTVDHAPKDLLGSVLGAFNVIGCLGIIFFVQIGGFLFDYIGPPAPFIFTGVGNLI
ISAYALRLVKSEARGVGGGNTPGDDEVA