TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q73JF2|Q73JF2_TREDE Membrane protein, putative OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_2623 PE=4 SV=1
MIAYSSALSQEKRRGFLDPRTKLALVLVLAVFVMGGLGGSQMKSIKIILSVLPFLLLLIERQWKRFGRGVIMLAVGYGLL
IAMPHLPGLLNFIALMCGGILTRFAVTVVMGGYLIGTTSVSEFISAMERLHIPQAITIPMSVMFRMFPTIGAEWKSIRRA
MGMRGIRLGGVRPGEVVEYQLVPMITSTVRIGEDLSAAALTRGLGSPIKRTNICRIGFRVQDLILLIICLAVVVMWILEL
CRVALW