TCDB is operated by the Saier Lab Bioinformatics Group
>Q74GA3|Q74GA3_GEOSL NADH dehydrogenase I, F subunit - Geobacter sulfurreducens.
MGEAIKILICQGTGGVSAGAKKVEAEFLRVIGEKGVDATVGKRCDVIKTGCRGLCANDVLVDIVDPELGRVTYDFVLPEE
VEKIVAEHIVNRTPLEKRKAKPYYNTFVDQQMRVVMTGCGQIDPESLDAYLEEDGFKAIEKCVKEMTPAAVIDEVKKSGL
RGRGGGGFPTGMKWSFCAATPGKLKYVICNADEGDPGAFMDRSILEGDPYCIIEGMMIAAYAIGCTAGYVYVRAEYPLAI
ERLQKALDVCYEKGYLGKNVMGWGFDFDLRIKKGAGAFVCGEETALMASIEGERGMPRPRPPFPAVKGLWGKPTNINNVE
TFANVRHIILKGADWYASLGTDTTKGTKIFAVTGKVKHTGLVEVPAGMSVREVIYNVCGGIANNRKFKAVQAGGPSGGCI
PSEVLDTPVDYDSLIKAGAMMGSGGLVVMDETTCMVDVARFFLTFTRMESCGKCVPCRIGLKAMLDILERITEGRGQAGD
IETLLEMGSTIKKASLCGLGQTAPNPILSTIKYFREEYEAHINDRRCPSNCCKELLLWQVVEEKCVKCGACFKACPVDAI
IWEKGQIAILDKEKCTKCKSCYDACRFMAIE