TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q78AW6|Q78AW6_SALSA Cardiac peptide OS=Salmo salar PE=3 SV=1
MVRTAVSWGLLLLLCQQTLVAAHVLGRPYPDSDLAQLKNLLERFEENLAAVATADDPAVDYEGPNPEPEHSKASPEWDRA
PEAPQRPLLSDVRELAADESYSRAQSQRSRLQDLLMATRSKAMSGCFGARMDRIGTSSGLGCSPKRRS